PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00083026001
Common NameGSBRNA2T00083026001, LOC106374243
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 275aa    MW: 31079 Da    PI: 9.1179
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00083026001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.7e-3852112262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+++cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  GSBRNA2T00083026001  52 PTKIIPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 112
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3538106IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3155110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2256110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MQESKDQEIK LFGMKIPLST VLEAEEDGIS AEKNQNETLT DQVEKDKTLR KPTKIIPCPR  60
CNSMETKFCY YNNYNVNQPR HFCKACQRYW TSGGTMRSVP VGAGRRKNKN NSSSSLHNYQ  120
HATISETNGP VLSFTHGDVQ KVSNNYRLMH SWPYMWNPGF YPVYPYWNVP MLSSSPNPSP  180
NSTLGKHSRD EDETIKPKHR NGSVLVPKTL RVDDPNEAAK SSIWATLGIK NEVMFKGFDS  240
KKEGKINNEE TETSLVLCAN PAAVSRSANF HERL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895971e-131AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013669769.10.0PREDICTED: cyclic dof factor 1-like
RefseqXP_013625763.10.0PREDICTED: cyclic dof factor 1
SwissprotQ8W1E31e-145CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078JQK10.0A0A078JQK1_BRANA; BnaCnng61810D protein
TrEMBLA0A0D3BFS90.0A0A0D3BFS9_BRAOL; Uncharacterized protein
STRINGBra010082.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-140cycling DOF factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]